Sequence for MER0041256

>MER0041256 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-261 ( active site residue(s): 106,222,250  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRTSSRAADLDIVEGTLPLGLPYRALGSGPPLVFLRWFTPDHANPAGLMARAEIAALAPL       60
61       AAHRRVYAVNRAPDMPSGTTMAEIADDHAAALRTEFSAPVDVLGISSGGSVALQLAADHP      120
121      DVVRRLVVAASASRLEERARVAQLRYAEAAAAGKRALHHMEPEPRTVRARINAAVMWLLD      180
181      PLARPRNPADTLAFVRAEDAFDVTDRLAAITAPTLVIGGERDEFYSPAAFRRTADGIPDS      240
241      RLVIVPGAGHMGAVRHPRFAAEVLAFLDH                                     269