Sequence for MER0041254

>MER0041254 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 1-241 ( active site residue(s): 99,203,229  ) (Nocardia farcinica) (Source: MEROPS) 
1        MNSTFAHLSSHGVRIAYRDSGPADGVPVLLVHGMGGDGHTWDRFARRLLRDGRRVIVPDL       60
61       RGHGRSSRAATYGFDEFGADLLRLCEHLGLDGVDLVGHSLGGYAVSCVAQERPALVRKLV      120
121      IEECPLPLRSGDEELSLTRRFPTVPELWHAASSLVRHPRAVWAFDRSMTRVALEQFRKPN      180
181      PQWWERLSEITAPTLVLRGGPGGMVDPEKLTVLTAAVADCTVTAFTCGHSIHRDRYREFE      240
241      AAVLPFLTA                                                         249