Sequence for MER0041253

>MER0041253 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 1-298 ( active site residue(s): 85,250,276  ) (Nocardia farcinica) (Source: MEROPS) 
1        MDGQTFHLVHVRSANPAATPLLLNHGWPGSFVEYQRLVPLLTEEFHVVIPSPPGFGFSTP       60
61       LSGTGWELARTTDACAEIMTRLGYPRFGAHGTDMGSGITGRLAAVYPERVIGTHIGADHR      120
121      WLGLVGDEFPLPDSLSDDEIAQLAAVRTEAAADRGYLAMQNHRPDTIGAALTDSPVGQLA      180
181      WIAEQFKTRPVGDHRTPDQSVDRDQLLTNISLYWFTRSGASSAQFYYECKHSDLDLLMAS      240
241      GVPSGWAVFDTHPLIRRVLDPGQAIGQWSEFTEGGHFPAMEEPELLADDIRAFFRRIP        298