Sequence for MER0041252

>MER0041252 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 1-255 ( active site residue(s): 90,213,243  ) (Nocardia farcinica) (Source: MEROPS) 
1        MVRVSTLHVHRFGPPDAPVVLALHGLTGHGARWAALAEEHLPDVRIIAPDLRGHGRSTAL       60
61       PPWDFETVVADLAELLRAETDGPVLVAGHSFGGATGVHLAARHPDLVRALVLLDPAIAIQ      120
121      PDRLADIAQRTLDEPDYPDVAAARRDKLASAWHDVAPRLLDAELDEHLVPTRPGRVGWRL      180
181      SLPAVTSYWGQLARPFVLPPAGLPTVLVQAMLVQPPFVTPAFRAALAERLGPALTIHEFD      240
241      CDHMVPLARPAETAALIRGLL                                             261