Sequence for MER0041251

>MER0041251 - Hip1 peptidase ({Mycobacterium tuberculosis}) [S33.023] peptidase unit: 97-555 ( active site residue(s): 269,497,524  ) (Nocardia farcinica) (Source: MEROPS) 
1        MDFLLHPCASAVGDGHVGVGTGFAVRGTRGQRLIAGPAGGNWQDRGMGLRRGCGVLVAAL       60
61       AVVAAGCTIERGEQAGPMPAAPAGLERFYEQAVPWGPCAGFTDDQVRLPPNAQCARIEVP      120
121      VDYADPAGPTAQIALSRIPASGAKIGSLLLNPGGPGVSGLDTVAIANQTPLSERFDRVGF      180
181      DPRGVGASTPAITCLTPPEADAERAERPEDNTPAGIAAAEADNRDYAAKCVQRSGAELLE      240
241      HVGTREVVQDMDVIRAVLGDPKLTYLGYSYGTKLGSLYAEKFPDRVRALVLDGAVDSSQD      300
301      PVQESLRQAAGFQRAFDAYAADCARTPDCPLGTDPAQAVARFRELVDPLWERPAATTDPR      360
361      GLSYNDAITGVTQTLYTDDLWQVLTLGLQELRDGRGDTLLQLADLYDGRRDDGTYRNTQD      420
421      AFNAIRCVDDPRVTDPAVAARQDTEYRKAAPFLDDGRGTGAAPLELCAAWPVPNSGEPHS      480
481      ISVQGLPTTVVVSTTEDPATPYQAGVDLAAQLGAALVTFRGNRHTAALVAGNECLDSAVI      540
541      AYLVDLTIPPAGLTC                                                   555