Sequence for MER0041249

>MER0041249 - signal peptidase ({Mycobacterium tuberculosis}-type) [S26.024] peptidase unit: 55-251 ( active site residue(s): 68,141  ) (Nocardia farcinica) (Source: MEROPS) 
1        MADESGSVRVSESDDEGAGRRGRRRGNRKTKQQRPFWQELPILIGIAAIIAALVVTFIGR       60
61       PYVIPSQSMEETLQIGDRIYVQKISYYAGDPQPGDVVVFVGPPSWNTRYQSIRSDNPVVR      120
121      GVQNFLSFFGLVPPDENDLVKRVIAVGGQTVQCCDAQGRVMVDGKALDEPYVQNDYRWLT      180
181      GQQNASYPAGRVFGPIKVPEGHLWVMGDNRNQSADSRAHVGDELQGTVPIENVRGKAVFK      240
241      IWPPTRLGPIRAEDPQGN                                                258