Sequence for MER0041248

>MER0041248 - repressor LexA [S24.001] peptidase unit: 106-216 ( active site residue(s): 140,177  ) (Nocardia farcinica) (Source: UniProt Q5YP21) 
1        MTDYDFEHLDTSALPVRQRRILEVIRDWVVEHGYAPSTRQIGAAVGLRSMSSVARHLRSL       60
61       EERGFLRRGEGVARPIDVRLFLHGTAAAAPSEDAVTVPVVGDIAAGAPILAEEHTDDLLT      120
121      LPRELVGRGTVFALRVRGDSMIDAAICDGDTVVVRSQREANSGDIVAAMIGEEATVKVFR      180
181      RRNGHVLLEPRNPAYDVIDGDEAVILGKVVSVLRRI                              216