Sequence for MER0041247

>MER0041247 - repressor LexA [S24.001] peptidase unit: 133-243 ( active site residue(s): 167,204  ) (Nocardia farcinica) (Source: UniProt Q5YT43) 
1        MSRTDDTGEESGVAVDPALNGADLTVRQRKVLEVIRTSVSERGYPPSIREIGDAVGLTST       60
61       SSVAHQLRALERKGYLRRDPNRPRAVDVRGLDEAVRAVTALPGAALEEPDTLAEDTGRPT      120
121      PTFVPVLGRIAAGGPILAEQAVEDVFPLPRELVGDGSLFLLRVVGQSMVDAAICDGDWVV      180
181      VRQQNVAENGDIVAAMIDGEATVKTFKRTGKDVWLMPHNPLFEPIPGNDARILGKVVTVI      240
241      RKI                                                               243