Sequence for MER0041246

>MER0041246 - family S16 unassigned peptidases [S16.UPW] peptidase unit: 531-811 ( active site residue(s): 702,745  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTTPRDLPVLFLTDPIVLPGMVVPIELDESAQAAIDAARAAGTDAVLLAPRLAEGYASYG       60
61       VIATIEQVGRMRGGAPAAVLKAERRAKIGHGVTGPGAALWVEAEPVETPPADGRTKELAA      120
121      EYKKLVVSVLQRREAWQLVDAVNQLTDASAIADTAGYAPYLTAEQKRELLETPDVAQRLT      180
181      VLIEWTKAYIAEAEVTEKISDEVRESMEKSQREFLLRQQLNAIRKELGEDEPDGADDYRT      240
241      RVEQADLPEAVREAALREVGRLERASDQSPESGWIRTWLDTVLELPWQVKTTDSTDISAA      300
301      RAVLDADHHGLDEVKDRMVEYLAVRARRAQRGLEVVGGRGSGAVLVLVGPPGVGKTSLGE      360
361      SVARALGRKFVRVALGGVRDEAEIRGHRRTYVGALPGRIVRAMKEAGSMNPVVLLDEIDK      420
421      VGSDFRGDPAAALLEVLDPAQNHTFRDHYLDLDLDLSDVLFIATANVMDTIPGPLLDRME      480
481      LITVDGYTEADKVAIARDFLVPRQLERNALTAEEVRITEAALREIAANYTREAGVRQMER      540
541      LIAKALRKAATRLTESASDPADSDSTVTPIRTGYDPELGYDEVVTDRGQTPLTIDVGDLK      600
601      EYLGRPRFTPDSVERTAVPGVATGLAVTGAGGDVLYIEANAAEGERSLTLTGQLGDVMKE      660
661      SAQIALTYVRSHLAEIGIEPSVLDRNIHIHFPAGAVPKDGPSAGVTMVTALVSLALGRQV      720
721      RADVGMTGEVTLNGRVLPIGGVKQKLLAAQRAGLKTVFIPARNEPDLDEVPAEVLAALDV      780
781      RPVADVADILAYAIEPVAEPAADGRPLAATA                                   811