Sequence for MER0041245

>MER0041245 - SepM peptidase ({Streptococcus mutans}) [S16.012] peptidase unit: 177-291 ( active site residue(s): 231,276  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLAALVPVLVLGVLGTVFTVPFVALGPGPTFDTLGEFDGKQVVEVSGAELDPTTGHLNMT       60
61       TVSVRDGLNLFEAFGFWASGRHGIVPRAEVYPPGVPREEIDRSNEQEFKDSEGAAEVAAL      120
121      HYLRLPTVVLVRQVGEEGPAKDVLRPGDEFVSINGAPVTSPQDVVNAVSSQPPGAPLTVV      180
181      FRRDNAEQTATVTLAARPDDASKGFLGVTPGEGARPPMDVTFNLADIGGPSAGLMFSLAL      240
241      IDKLSPGELGGGKFIAGTGTIEQDGKVGPIGGIQYKMMAAREAGAEAFLVPAANCNEARQ      300
301      RIPDGLRLVKVETLDGAVQSLAALGSGGETPTCG                                334