Sequence for MER0041244

>MER0041244 - DNA repair protein RadA ({Escherichia coli}) [S16.A04] peptidase unit: 282-434 ( active site residue(s): 368,411  ) (Nocardia farcinica) (Source: MEROPS) 
1        MAKTKAIFRCSACSHEVAKWVGKCPDCGAWGTVDEVAVSAGAPGAPGRRAMLPSTAAAPI       60
61       SAIDSQVTKARPTGVSELDRVLGGGVVAGSVVLLSGEPGVGKSTLLLEVAHQWARRPGEK      120
121      ALYVTAEESAGQVRLRADRTGAVHEQVFLAAESDLSIVLGHVEQVRPTLLVVDSVQTMLA      180
181      PEAEGVIGGVTQVRAVTAALTSLAKASGIAVLLVGHVTKDGNVAGPRTLEHLVDVVLQFE      240
241      GDKNSTLRMVRGIKNRFGSADEVGCFELHEDGIACVDDPSGLFLHHRTDPVPGTAVTVAM      300
301      DGKRPLVGEVQGLTVKTEIPAPRRAVSGLDYNRVAMVLAVLQSRGRVFLGKHDVYAATVG      360
361      GMRLAEPAADLAIALAIASAECDTALPAGWVILGEVGLAGEVRKVTGVARRLAEAERLGF      420
421      TTALVPPGSERLKGATIRVHEVGDVRSALRISGLRGRKSGGD                        462