Sequence for MER0041242

>MER0041242 - ClpP2 peptidase ({Streptomyces}-type) [S14.009] peptidase unit: 1-197 ( active site residue(s): 101,126,175  ) (Nocardia farcinica) (Source: UniProt Q5Z0M4) 
1        MSTYTIPNVIAQHPRGGERITDIYSHLLAERIVYLGTPIDSGVANALIAQLLHLESESPD       60
61       QEINFYINCEGGDLPSMLAVYDTMQHIGAPVHTTCVGQAIAVGAVLLAGGAPGQRAMLPH      120
121      ARVVLHQPAARGQGPIPDLILQADELVRMRSEIEAILSRHTGRSPEQLREDTDRDRVFTA      180
181      TAALEYGLIDTVLSPRG                                                 197