Sequence for MER0041241

>MER0041241 - ClpP2 peptidase ({Streptomyces}-type) [S14.009] peptidase unit: 8-216 ( active site residue(s): 118,143,194  ) (Nocardia farcinica) (Source: UniProt Q5Z062) 
1        MALIDPRAGLSGIAPSSPQARYILPSFIEHSSFGVKESNPYNKLFEERIIFLGVQVDDAS       60
61       ANDIMAQLLVLESLDPDRDITMYINSPGGSFTSLMAIYDTMQYVRADVATVCLGQAASAA      120
121      AVLLAAGTPGKRACLPNARVLIHQPSLEGGIQGQVSDLEIQAAEIERMRRLMETTLARHT      180
181      GKDPDTIRKDTDRDKILTAEDAKEYGIIDTVFDYRKLSAQK                         221