Sequence for MER0041240

>MER0041240 - family S14 unassigned peptidases [S14.UPW] peptidase unit: 1-188 ( active site residue(s): 92,117,166  ) (Nocardia farcinica) (Source: MEROPS) 
1        MAHDDKTPLFGWRAREQLLSRRILVLDGPLDDDNGTLLATQLLTLAAENDEAPISLWIHS       60
61       PGGSVPAMLAIRDVMRLVPCEVSTLALGLACSAGQFLLSAGSRGKRFALPHARVLMHQGS      120
121      AGIGGTAVDVEVQADDLRHTVETVLGLIAADTGQPYDRIYEDSLHDRWFTAAQAKEYGFI      180
181      DHIVDSFGQVVPQRPRVGITL                                             201