Sequence for MER0041239

>MER0041239 - ClpP1 peptidase ({Streptomyces}-type) [S14.008] peptidase unit: 1-196 ( active site residue(s): 100,125,174  ) (Nocardia farcinica) (Source: UniProt Q5Z063) 
1        MTKNQAGVMTSATAGLNLSDSVYERLLRERIIFLGTQVDDDIANKLCAQILLLSAEDPTR       60
61       DISLYINSPGGSVTAGMAIYDTMQFAECDIRTVGMGLAASMGQFLLTAGTKGKRYALPHA      120
121      RIMMHQPSAGIGGSAADIAIMAEQFAHTKRELNELQALHTGKSVEQVTADADRDRWFTAQ      180
181      EALEYGFIDHVISHANQANGIGG                                           203