Sequence for MER0041238

>MER0041238 - penillin-binding protein 4 [S13.004] peptidase unit: 73-475 ( active site residue(s): 114,117,292  ) (Nocardia farcinica) (Source: MEROPS) 
1        MAARRRRRLWIGATAAATALLLAVAAVLLVVRPWTPEFRHGGLTVAAPPAPVKAFPRVTP       60
61       ATEAPAPSPAGVSTALAAAVTNPDLGAFTGIVTDAESGVTLWSADPGRPMIPSSTAKILT      120
121      AAAALLALPADRRVATEVVVGSAPGELVLVGGGDPTLTAQPDGKGYYPNAARLSDLVDQI      180
181      KASGRAVDTIVVDTSAFSGPTMARGWDPIDVPEGSIAPIEPVMIDGGRLSPLVEYSPRTT      240
241      EPALDAGRALATALGLDPARVRAGTAAPDAAEVAAVHSAPLRDRLRDMMVHSDNVLAETI      300
301      GREIALATGHEPSFTGAVAAVRATLEKAGFDVSGMDMHDTSGLSVDDRLPARLLDKVIAT      360
361      AAQPTGTALARPAGTKAEPESDRLAATLAPLLDQLPVAGATGSLAERYVTRNREGAGWVR      420
421      AKTGTLTVASALVGYVLDRDGRVLTFALMSNDRPPEVSRPALDAIAGTLRNCGCS           475