Sequence for MER0041235

>MER0041235 - alkaline D-peptidase [S12.003] peptidase unit: 15-359 ( active site residue(s): 76,79,176  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLVGLCVGSTLLLVGCSTVQRASALQRDLDAVTAAGVAGAVATVDDRTTSLVITSGVADR       60
61       STGAAMPEHGRVRIGSVTKTFTAAIVMQLVAEGKVALDAAVDTYLPGLLTGDGVDGRVIT      120
121      VRQLLHHRSGLPEFAGRPGADELIAAAENRTLAPVEAVSTALAHPAQFAPGTRYAYTNTN      180
181      YIVLGLLIERVTGRSYADELRDRIIAPLGLTDTYLPAPGEREIRGEHPHGYLDTPDGVID      240
241      VSRIEPSIPWAAGALVSTGRDLNIFWRALVDGRLVPAPQLAEMTTPQDGASEDEGRGYGL      300
301      GVGATELSCGVRYVGHSGGIPGYHTMSGATPDRAATITFTQAPRTPPDSKALLEHALCP       359