Sequence for MER0041234

>MER0041234 - family S12 unassigned peptidases [S12.UPW] peptidase unit: 1-281 ( active site residue(s): 24,27,108  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLDPVSPDAWCLHSAAVTVTPVYSIAKIFTAAAALRCLDPEREIGAVAPVPARLAGLRVG       60
61       DLLTHRSGLGDYGAWPEYRRAVAERGDAWPEEVILERVELARPGVFRYSNPGYLLVRRAL      120
121      EEQHGDRFFPVLRRLVLDPLELPAHPFASRADWAHCTVEIPAGVRAYDPRWVYPGTFCAD      180
181      VTDTAAALARLLSGTLGAELPTAMCRTHPVDAPGHPLSDPGYGAGLMTSGNPPAIVGHGG      240
241      GGPGFTLFAAARVDGSAAHGTVEARECDDAPLIRRCLAALR                         281