Sequence for MER0041233

>MER0041233 - GYO_0385 g.p. ({Bacillus subtilis}) [S12.A23] peptidase unit: 113-290 ( active site residue(s): 113,116,204  ) (Nocardia farcinica) (Source: MEROPS) 
1        MCLASRSSRGAGALKPTKYVATLWITLLLCAVAGTFGGTAQAAEWKHCAPPQGRQFETAT       60
61       PEEVGLDPAALQKVSELVANPTRLNFKIFRNGCLVVTGPANERTGALPWNLWSATKSVVS      120
121      LVAGIAADEGKLDLDAPIGEYLPAGLGDEAHRAILVRNLLTESSGIDVAIIAEGVTGVTG      180
181      LDANVVAQALGTPIEAPQGTKYGYSQRGVDLLAYVVAQAVGEDLQDYAQRTLFDPLGIDR      240
241      ADYHWARDRSGNTYGHAHLVLAPDDFAKLGLLVADRGRWGDRQVVSAAYLARASEPSPAM      300
301      KCWGFLFVVNGPGCGSEFAGLPADAVKMSGMLRQDNYIVPSLDLVVSWTGVTVPGSAVSY      360
361      PHDVLRAIGAAFRDPVLPDPGPYVPQPDVSLSDPRMSDPTATFAALGLGPYAYPGCDPVV      420
421      CLGKPLPPPFSDWPSGCIILGCFTPRPGD                                     449