Sequence for MER0041231

>MER0041231 - GYO_0385 g.p. ({Bacillus subtilis}) [S12.A23] peptidase unit: 89-268 ( active site residue(s): 91,94,182  ) (Nocardia farcinica) (Source: MEROPS) 
1        MAAVTLVAGALAGAAQAAPDPGYAECAVTSGRTPQRAAPEAAGFDSGRLDEALRFAAERN       60
61       RFNVQVFRHNCLVGEGPNNAHTGHVPWNIWSSTKSVVSLLAGMAAERGLLDLHAPIDRYL      120
121      PAGLGDAEHRSITVEDLLTETSGMRVGVLTEGITGVIPIDPHSAVQALGVPLANPPGTVF      180
181      SYSQRNVDLLAYVIELALGEPLQQFAQRELFDPLGIAREDYYWARDRAGNTYGYAHLMLP      240
241      PDDFAKLGLLVADDGRWGAQQIVPADYLRQARTPSPANRCYGYLFWLGPGCAEIPAFLPS      300
301      GVYAMAGLGLQNVFVLPELDLVVVWTGAFGNVSAHGVQGIVQNTGELPWEFFRKLFAAMH      360
361      EPPVPDPGPYVEPPLRTDPSRYVDNSLLLAVFGVGPAAYPGCNVFSCLNYELAAPFADAP      420
421      PGCYVLACLGPDPRTPGIR                                               439