Sequence for MER0041230

>MER0041230 - family S12 unassigned peptidases [S12.UPW] peptidase unit: 11-383 ( active site residue(s): 64,67,153  ) (Nocardia farcinica) (Source: MEROPS) 
1        MQAIEVHGTVADGYEQVRAEFAAVVAEEDGESGAQLAAFVRGRKVVDLWAGREVSGTTLT       60
61       GLHSTSKGAAGLVVALLIQDAALDVDRPVAHYWPRFAAAGKDRITVRDVLVHRSGVVGAD      120
121      GGFTVDELADERVVAERLVGQRPFFEPGSVHGYGGFVTYAIIGEVVRAVTGSTIQEHFEQ      180
181      RIRAPYGLDVYLGLPAELDHRYLPILPWRATPEMEAAFAANSPNPHGIAGVSYNLNARGF      240
241      TAADVMALPNDAKLRRLGQGSAGGVGSAHGVAAMYAAATTGIGDREPLLSLETIATISAI      300
301      HSHGPDLVRGDRVAYSLGFEAKSLLYPFLGAHAFGHTGSAGSDGFADPHSGLAYGYTRRR      360
361      AAFAFNAPENARLAAALHRAATTTGLATAA                                    390