Sequence for MER0041229

>MER0041229 - lact-2 g.p. ({Caenorhabditis elegans}) [S12.A11] peptidase unit: 12-389 ( active site residue(s): 68,71,157  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSNDASVHGSAPPEFGQLVRVFGRTFGRRPGAGAALAVHLHGEPLVDIWTGEAGTEAWTR       60
61       EHGTLIFSATKGVAATAMHRLADRGLLDYNAPVAEYWPEFAANGKSRITVRQVMTHSAGL      120
121      SALSPLVEGFADVLDHELMEERLAAAKPDRLLGVPTYHALTYGWLLAGLARRITGKSMSE      180
181      LLRTEVSEPLGIDGPHLGHPPAEATTRYAPLAGNQLGLLGTPLGNAVMGRGHLLPGPLGA      240
241      AVRCLFLPGVHTILEGEHPPILRTELAAGNGVATASALARVYDVLACGGVVDGKRYLSAA      300
301      TMREIAKVRTYRLDHALFYLPMMWHLGYHSLPMPGARSGLGHIGLGGSFGWADPRLGLSV      360
361      GFVHNRLSAGQLGPDQLIAVWLLPLILTGLRGVRRGTAPQLRRAA                     405