Sequence for MER0041228

>MER0041228 - family S12 unassigned peptidases [S12.UPW] peptidase unit: 76-424 ( active site residue(s): 131,134,222  ) (Nocardia farcinica) (Source: MEROPS) 
1        MPCNSSEEVRAVPGRRRVAVGLLALGLVVGACADDSGGDAATTSSAPRSPAATGELPPNE       60
61       VAGVAIPDGQVDRAVGELDRIAGELMDATKIPGMAVAVVHDGKVVYSKGFGVRDVTTGQP      120
121      VGPDTVFQLASLSKPIGATVVAREVAAGRVAWDTPVRRLSPEFTLADPYVGDHVTVGDLY      180
181      AHRSGLPDHAGDLLEDLGYDRAAILARLRQLPLAPFRDSYAYTNFGLTAAASAVAQAAGT      240
241      DWETLSQREIYEPLGMTSTSSRYADFVARGDRAVGHVLVDGAYRPADPPRRPDAQSPAGG      300
301      VSSSARDMTRWLTMMLGDGSVEGREIVPPAALLPAVSPQMMSAPPANPDARAGFYGFGFN      360
361      VGTSPAGRVVLSHSGAFNLGAGTAFTMIPSAGVGIVTLTNAAPRGVPETLNAEFADLVQF      420
421      GEVREDWRGLYTEAFDQLDAPKGDLVGKEPPRAPAPARPLTDYAGTYANAYYGPATVAVR      480
481      GDELTVTLGPAGTVVPLRHWDGDTFAFTPSGEGADPGTVSQARFDGDRLTLEYYDQDGMG      540
541      TFTRG                                                             545