Sequence for MER0041226

>MER0041226 - family S11 unassigned peptidases [S11.UPW] peptidase unit: 108-434 ( active site residue(s): 139,142,194  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTARLSVPLRRLTAALTVAAALGAAVAIPAAAAPTAPTPPTTTAPFTTPETDTCPQKNVP       60
61       PPAVDTSEVPAPGEPAPTPLPVPVPPIGGARMGECGVVVPDDAPPLPRDISATAWMVSDL      120
121      DTGEVLAAKDPHGRYRPASTIKVLLAIVALRTLDLDRVVTGTQADADVDGTRVGIGPGGR      180
181      YTNRQLMQALIMASGNDAAHAIAAQLGGDKATVARMNEVAKSLSAFDTRAATPSGLDGPG      240
241      MTTSAYDLSLLFREAMTIPLFAELIRTEQIDFPGYPKNPLIPDDTDHPGFPIGNDNQLLY      300
301      NYAGALGGKTGFTDDARQTFVAAAERDGRRLVVTLLKADVLPIRPWEQAARLLDYGFALP      360
361      AGASVGSLPGAATDATDTEPNVVLAAPPPDDDETATAAQPERRHAGARTLLIVGGLVAIA      420
421      VLLLGARRVSRPRR                                                    434