Sequence for MER0041224

>MER0041224 - subfamily S9B unassigned peptidases [S09.UPB] peptidase unit: 46-306 ( active site residue(s): 157,256,285  ) (Nocardia farcinica) (Source: MEROPS) 
1        MIPRANAGRRRAAQGEIRAVVRLCALVLHRERHLVARVHLCLTDSVPSASATTRIRTLDG       60
61       LHLAATLVTPEQPATHAVLLVHGGGVTREEGGFFTRLAAGLADVGIASLRFDLRGHGESE      120
121      GRQEELTLSSILNDIRVCLAHLRDATGAGELSLVGASFGGGICGYYTAKRPDELARLVLL      180
181      NPQFDYKKRTIDTRPYWTDDVINDEAARELNETGAIQFTPTLKHGRPLLNEVFWLRPNEV      240
241      LGEIKTPTLIVHGNADTLVPIDGSRAAVAQFTAPVELVEIDGSQHGFAVHDDPQYLNPKS      300
301      QEYQAEVIGIVSQWLRHQDVA                                             321