Sequence for MER0041223

>MER0041223 - family S9 unassigned peptidases [S09.UPW] peptidase unit: 1-290 ( active site residue(s): 112,242,269  ) (Nocardia farcinica) (Source: MEROPS) 
1        MERLEVSFVSGGQQCAAWLYPPAGVPKPRPLVVMGHGLGGTRDMGLDRYARRFAAAGMGV       60
61       LVFDYRHFGASEGDPRQLLHIGRQREDWRAAIAFARTLRGIDKTRIALWGTSFGAGHVLT      120
121      VAPEDDYIAAVVAQVPFTSGWASAWAKGPTSLTKVATIAATDLVIGSLRRKPVRIRLAGR      180
181      KRAAALMSAPDVPEGYGRLAEESATYEPKVAARVAFSALFDAPGKHAKELKMPVFYAIAD      240
241      NDSVAPVEPALKAAERTKHAVVKRYPVGHFDVYFDDVFEQAVYDQTEFLVSVLRP           295