Sequence for MER0041222

>MER0041222 - para-nitrobenzyl esterase ({Bacillus subtilis}) [S09.948] peptidase unit: 70-432 ( active site residue(s): 194,288,411  ) (Nocardia farcinica) (Source: MEROPS) 
1        MVATIDITTADGVVRGRRGRRVLRWRALPYAAPPVGELRFRAPQPVQPWSGVRDATEFAS       60
61       ASFQHRGGARIGARTYQPTSEDSLTLNVIVPATPAITPRPVMVFIHGGGYVMGTSALGLY      120
121      SGARLALRGDVVVVTLNYRLGAFGYVDFSEFATPARPFDNNLGLRDQVAALEWVRRNIAA      180
181      FGGDPDNVTIFGESAGAHAVLALLATPAAHGLFHRGIAQSPPADWGLSAADAAEFARRLV      240
241      ERLGIDPADAARALTDLPANDIRRAADRAMAAAGRQRPGFFPICPVADGDYLPQAPVDAI      300
301      AAGTAAAVPLIIGTCRDEGQLFARFADYLPTNPDRLHRILSAEGDEVEKRVVAAYPGYPG      360
361      ARAAVRMGGDYVFWRPSVEVMEGHSRHAPTYAYRYDYAPRALQLAGIGATHATDLIPVFG      420
421      AADTPLGRALTAAGGARGLAAVTRQFQDNWLAFARTGTPLPSWPEYTEENRLTLIIDDPT      480
481      RVIGDPDRERRLAWSGVRVPTLT                                           503