Sequence for MER0041221

>MER0041221 - family S9 unassigned peptidases [S09.UPW] peptidase unit: 56-313 ( active site residue(s): 167,262,292  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTVPTGHPPYRFAWDPDVAVLVAAIESHRAGTLRDGGVAAARRSLESIVRPPGPAMASVR       60
61       DASIEGPHGDIPVRVYRPHTAPESDASALVWFHGGGMIMGSLHSFDRLARDIADATGAVV      120
121      VNVEYRLAPEHRYPVANDEAYAALCWLHENAAAWGVARSRIGVGGDSAGGSLAAATALRS      180
181      RDEAGPGIAQQVLFYPGIERRTDRPSMREFGDSPFLTAADIDWMKSLYLGEDPATDDAYG      240
241      VPALADSLAGLPPAIIAVGYADPLRDAVEAYGDRLRAAGVPTAQLRYPGMGHGFAMQTAN      300
301      VARARAAMAEVGALVAARFRHEP                                           323