Sequence for MER0041220

>MER0041220 - hormone-sensitive lipase [S09.993] peptidase unit: 99-348 ( active site residue(s): 203,297,327  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTVTAQAPAPAQAPAALSVAERLQRAAFTALGSIPGGLLRRIAPRVVNADGDVLAPEIAL       60
61       LLKATASAPDFSDGTPEQARAIVANDSRVFADKAPAGVRVEPEIVLPTGLRATMYRPAVP      120
121      SNALVLFLHGGGFVLSSRQDYDVPVRLIADGAGVNVLSVEYGLAPESPFPGPVDDAVTAW      180
181      RFAVEHCAQWGIDPARIVLLGDSAGGNLCAVLANIVAGEQVRPFLQVLMYPVVDAVGNYA      240
241      SRKEFADNAALSAKQIDWLTDLYLPDRTYALDPRVSPILAEDLSGAPPTLITVAGFDPLR      300
301      DEALAYAARLEEAGIPVRVFRESGLVHGYVSMTRISPTARAALDRVTDAVRTALEES         357