Sequence for MER0041219

>MER0041219 - family S9 unassigned peptidases [S09.UPW] peptidase unit: 5-296 ( active site residue(s): 117,249,275  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSTRTEMAFDSHGTTCHAWYFHGGDSPFAGERGRPVVVMAHGFGGTKDSGLEPFARRLAA       60
61       AGLAVFAFDYRGFGSSEGQPRQRVSMRGQVEDYRAAIAAAGRAPGADPARIVLWGVSQSG      120
121      GHALTLAAERADVCAVIALVPMVSGLAAGRHAFAQRGAAPMAAATLAGLRSAVATRLGAA      180
181      PTMMPLVGRPGERAALTAPGYYESYRALAGPTWRNEVDAAVGLELGGYRADRHADRITAP      240
241      VLVQIADFDRAAPAHAAAKAAFAARAEVRHYPCDHFDVFAGNPWFDPVVDHQLRFLTRKL      300
301      GSAGQPAPATAEAAE                                                   315