Sequence for MER0041218

>MER0041218 - subfamily S9C unassigned peptidases [S09.UPC] peptidase unit: 41-290 ( active site residue(s): 145,239,269  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSGLGMRAVGLYLRLTSRRRMATAERARARMAAPKGSAAPPARLRARHTVTERRFGQFTT       60
61       YTVTPRHRAPHCAVLFLHGGSYIAEIARQHWGLIARLVDHGARVDVPIYGLAPRFTHHDA      120
121      YPFVTEAYRAMAAEAPGPLTVLGDSAGGGLALGFTQTLAGLDEPVRRPDRLVLIAPWLDL      180
181      TLSNPDMAAVDDPWLTRAGLLEAGRAWAAGTDPTDPRLSPLNGPMDALPPTDLYIGTRDL      240
241      GYPDACAFRDRATAAGVRVEFTVCGGALHDYPLLPTREGRAAAARIARAVCASR            294