Sequence for MER0041217

>MER0041217 - hormone-sensitive lipase [S09.993] peptidase unit: 59-307 ( active site residue(s): 163,256,286  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTEMGAQRRSDLHPDVAAMLAALESFPDVTRYEAAELREIIAARRAPLTRQPDMRTARDH       60
61       VIPGPGGDLTVRVYVPHGDALRPVVVFAHGGGFVFCDLDSHDEFCRSTAQAVDAVVVSVD      120
121      YRRAPEHPGPAAMEDLYAAVTWVHRHAGEFGGDPERIAVAGDSAGGNLAATVSLAARDRG      180
181      GPPIAAQVLIYPVIDDDFDTESYRRYGAGYYNTTEAMRWYWQQYAPHGTDSPYLVPTRAD      240
241      SLAGLPPAVVVTAELDPPCSAGEDYARRLAAAGVPVTAHRFDGLFHGFLTFPKLSLTGPA      300
301      RAELWQMMRAVLASPRPAVGEGTA                                          324