Sequence for MER0041216

>MER0041216 - family S9 unassigned peptidases [S09.UPW] peptidase unit: 52-302 ( active site residue(s): 156,251,281  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSVPPLDPDVAARVAALGTVPSMRSRGIEAVRSGVEAMAPPTSMPAVAQIENHTVPGPYG       60
61       PLDLRIYRSTTGPAAPVVIHLHGGGLAMGSNASFEPLARHLARASGATVVGVDYRLAPEW      120
121      PAPVQVEESYAATVWVAEHARELRVDPERLVVLGDSAGGGLAAGVALMARDRGGPALFAQ      180
181      VLLYPGLDRDLGAASVVAMPDAPMLSREDILYLHELADAGSSRPADCYRVPAYATDLSGL      240
241      PQAIVVTAAGDPIRDWGERYAARLRDAHVQTTLTRYPGVLHGFLMRPENSARALLAIAET      300
301      GALLRAKFDNALPWPTRAAGS                                             321