Sequence for MER0041215

>MER0041215 - subfamily S9A unassigned peptidases [S09.UPA] peptidase unit: 406-689 ( active site residue(s): 541,624,656  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSGVEQNVTDPYLWLEDVTDERALDWARAHNEVVAARFAATERFARLEQRILDMLDTDTK       60
61       IAYPGRRGRWLYNFWRDAEHPRGVWRRTTFAEYAQPSPDWDVLIDLDALADQEEENWVWG      120
121      GAAVLRPEQRRALISLSRGGADAKVVREFDIETRQFVAPEDGGFYLPEAKSEIRWIDADE      180
181      VYVGTDFGPGSLTDSGYPRIAKRWRRGTPLEQARTVFEGEPGDVAVSAGYDRTPGYERHF      240
241      VGRATDFFNEEVYLLDPDGTPRLLEVPTDASESWYKDWLLVRLRSPWEVGGTTYPTGALL      300
301      ATDFPSFLAGERRFDVLFTPDAHTSLHGYGWTENHLLLITLQDVQTKLHVLTPGADGWAI      360
361      EPLADTPPMATTSVINLDPLEGGDEFMLTTSGFTTPATLLAGSVGGPTTTLKQEPGFFDA      420
421      AGIETEQFFARSDDSTMVPYFVIRHRDRKGSPGPTVMSGYGGFEVSRTPAYSGASGMGWL      480
481      ERGGTWVMTNIRGGGEYGPEWHTSVQKANRHKVYEDFAAIARDLVARGITTPDQLGAVGG      540
541      SNGGLLMGVMLTRYPELFGAIVCQVPLLDMKRYHLLLAGASWMAEYGDPDKPEEWAYIRE      600
601      YSPYQNVRADADYPPILLTTSTRDDRVHPGHARKFAALLEEQGHTFWYHENIEGGHGGAA      660
661      DNKQMAFQAALIYEFFTQMLMERRTAARD                                     689