Sequence for MER0041214

>MER0041214 - hypothetical protein flj40219 [S09.958] peptidase unit: 63-398 ( active site residue(s): 184,343,377  ) (Nocardia farcinica) (Source: MEROPS) 
1        MDNVVEAPSGGWRGVVADGVRTFRGIRYARAERFAAPEPEPAHDGVIDASTRGPSAPQLP       60
61       SRLEAVMGAPAAFEQSEDCLRLTVTAPVQPPPGGSAVLVWLHGGAYLTGGGEWNLYDADR      120
121      LVRETGIVVVSVSYRLGVLGWLRAAGVSEGNLGLLDQLAALGWVRENIRAFGGDPARVTV      180
181      AGQSAGGQCVAAMVGMPRARGLFAQAIVQSAPFGIGFHDAAAAERAAAVFLAELGTDPRT      240
241      APVPELLAAQARTAIRRAGPGGLNAAPPFLPVEETDVLPGPAQWAAAVRAAPVPALVGCT      300
301      AAEMRAFFGGPHPVFGRVRRIPVAGPRMVTLAERVVGRKAFEDGVFRFADLLTDAGAVAR      360
361      CYRVGALHPGSPLGACHCIELPLLFGDPDDWRAAPMVRPTTPAELDELGARTRRSWGEFV      420
421      RTGAVADWPAHRHGSRAVRQLP                                            442