Sequence for MER0041213

>MER0041213 - family S9 unassigned peptidases [S09.UPW] peptidase unit: 108-329 ( active site residue(s): 205,298,329  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLRRSLLRGLLKCKCVRCRRRHSLVRHRAVRPGRCGGAAARRCAMVVLNPEGPSAQARLL       60
61       TAACRGVVRPVLRAAPITRATIPVGALAIDGLARLRPHPRGIEREQVTMPGFAMEIIRPA      120
121      GAARAMRHGALLYLHGGGFAVCGLETHRPVAASLARRTGLPVVNVAYRQLPVRSITESID      180
181      DCLAAYRWLLRHGAEPDRIVFAGDSAGGYLTFATALRALECGLPAPAGLVGLSPLLDLDY      240
241      AAKRDYVNVARDPYIPLSALAAVVRLGAEREGRLDPLLSPVNGALAHLPPVLLVAAEDEV      300
301      LRFDAELMAARLDAAGVPNSVELWRGQVHAFMSIAPGLPESRAALGRVARFVRGRLADSQ      360
361      RARTA                                                             365