Sequence for MER0041212

>MER0041212 - hormone-sensitive lipase [S09.993] peptidase unit: 54-309 ( active site residue(s): 165,258,288  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRDARRLIRDAGLATMIGMDPELEPFLPLFPPSDLSDIPQARRQLAELAAAVPADIAAHL       60
61       DIEDRTVPGEPAVPVRIYRPQHARGAIVWAHGGGFVMGDLDTEHPWATRLADGSGATVIS      120
121      VGYRLAPEHPFPAAHDDMYAVLTWAAAHADELGIDPARIAVGGHSSGAGIAASVALRARD      180
181      EQGPPICLQLLNQPGLDDRQRSWSARNFTDTPFLNRSKVTQMWEYYLQGTPATPYAAPAR      240
241      ATDLSGLPPAYIATAEYCPNRDEDIDYALRLLWAGVPVELHQWPGTFHGSQAIVSAAVSQ      300
301      RQNEEFAAALRRAVGEP                                                 317