Sequence for MER0041211

>MER0041211 - family S9 non-peptidase homologues [S09.UNW] peptidase unit: 42-289 ( active site residue(s): 149,238,268  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRELNIPLPVLRAAINPLFRVMLNPRLPFTVQRTLMDAASRIQFVPAGTTVRRTRLGGRP       60
61       AEQLTAGRAEPTTAVLYLHGGGYAVGSMATHRSLAARLAHETGAAVFLLDYRLAPEHPFP      120
121      AALDDAVAAFDELVAAGYGPESIAIAGDSAGGGLSLATAQRLLAEQNRRPAALGLIAPWT      180
181      DPTGTPARERDLVVSRPWALACAAAYLGDGDPGVPGYAPLRASMHGLPPTYVQADIDELL      240
241      HEQCVELVQALRDAGVHVRFTESRGLWHVAQLQASLAAPAAAAVRELSEFLREALQPVDM      300
301      RHLG                                                              304