Sequence for MER0041210

>MER0041210 - family S9 unassigned peptidases [S09.UPW] peptidase unit: 63-314 ( active site residue(s): 171,261,293  ) (Nocardia farcinica) (Source: MEROPS) 
1        MPMSSDGSRPIPLPAVSRRRVLAAVVAVFAAAGCAAGERTAAPPSVVTTLAGPPPATPDA       60
61       PLRIAYGPDPDHIGDLYLPERGAAPYPVVVMVHGGGWSQWRDLDDTAGNSTALARHGVAV      120
121      WNIEYRRVRGGGGWPSTLADADDAVEALATVVQERSGHRLDLERVHVAGHSAGGHLAAWV      180
181      AGRHTLPPTAPGAQPRVRPRSATLMAGVFDLELAVTRGHDAFVRALLDGAPDEVPDRYRI      240
241      ASPIAHLPVGIRIDALHGDADQVVSIEQSRRYIAAARAAGDNAHLHELPGVTHADFLDVG      300
301      SPAWAAAQRVILHNIDTLD                                               319