Sequence for MER0041209

>MER0041209 - family S9 unassigned peptidases [S09.UPW] peptidase unit: 80-448 ( active site residue(s): 203,325,427  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTIRYDTTVEIDDAGPVAHTTHGRVRGVMDGPIAVWRSIPYAAPVTGPRRFRPAEPPEPW       60
61       DGVRECVRFGDIAPQTMGTMVPVDSELRMGEDCLWLNVWAPTEPREPEEPRPVLVWLHGG      120
121      AYCLGTAAQKIYDGRKLAETGDAVVVTVNYRIGVLGFLDLSSVVDGCTPNLGLHDQIRAL      180
181      EWVRENIAAFGGDPDNVTLFGESSGAGCVTALLTAPAAAGLFHKAIAQSPPATTVFGRQR      240
241      AELVAHRFLELLDLPPDRAAEVGELPIERLVQAAGVLFDEVPLREPGRLAAAPVVDGELL      300
301      PDYPITRFQQGRSHRVPLIIGTNKDEASLFRLFRSPIMPVTPEAVTIMLRDVAESHPDMS      360
361      PERVAEIASAYPDLGKARGALAMSTDAAFRMPAHWVADGHCTHSMTWVYRFDHATPMLRA      420
421      ARVGAGHATELPYVFGNFGTLNHDPTFWLGGRKQATEVSGRMMRRWLAFARHGVPAALDG      480
481      SKHWPPYDRDTRHTLLIDAIDRVVDDPDRDLHTAWGDQAVGFS                       523