Sequence for MER0041208

>MER0041208 - oligopeptidase B [S09.010] peptidase unit: 430-716 ( active site residue(s): 567,653,688  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSVESGVAAPIAKRVPTERVHHGDVFVDEYEWLRDKENPEVIAYLEAENAYTEAQTAHLS       60
61       GLREKIFEEIKSRTQETDLSVPTRMGEYWYYSRSFEGKQYGVHCRCPIDTTADAAAAWNP      120
121      PQLEAEGEIPGEEVLLDSNELAEGHEFFALGAFSVSHDGTLLAYSVDTVGDERYTLRIKD      180
181      LRTGELLADEIAGTAPGATWSLDGTHVFYQTVDESWRPDTVWRHRLGTGTDADVRVFHEP      240
241      DERYWVSIGATRSEKYLMIWVGSKITTEGWVLESDDPEGEFRVLLPRREGVEYSAEHAVI      300
301      GGQDRFLILHNDVVDGVKAQNFVLAEASVDNPADLRILIGHRDDVRLEDIDAFADHLVLS      360
361      YRREALTRLAVWPLTETGYGDLRELEFDLELFAVGMGGNPEWAQPTLRLGLTSFITPMRV      420
421      YDYVPATGELLLRKEQPVLGGYDAGDYRQRREWAVAADGTRVPISLVWKTGVADPGVEPR      480
481      PLLLYGYGSYEASMDPSFSVARLSLLDRGMVFAVAHVRGGGEMGRLWYENGKTLTKKNTF      540
541      TDFVACARHLIDTGVTAPDRLVADGGSAGGLLMGAVANLAPELFAGILANVPFVDPLTSI      600
601      LDPSLPLTVIEWDEWGNPLADKDVYEYMKSYSPYENVEAKDYPAILAITSLNDTRVLYVE      660
661      PAKWVAKLRATKTGDAPLLLKTEMSAGHGGVSGRYAKWKEVAFEYAWVLDTAGLGE          716