Sequence for MER0041207

>MER0041207 - subfamily S8A unassigned peptidases [S08.UPA] peptidase unit: 76-399 ( active site residue(s): 115,147,268,339  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSEPTHVLAGEKLVVLRAPARAVLREPNAGPAAFPAEVAADVRIDIDEVDAATLRSVAAD       60
61       PTVVGFGPAMPMRLVEPAERGGVVAAAAGPTWGVEAVGATTSPFTGQGVTVAVLDTGIDA      120
121      DHPAFAGVDLVTRDFTGGGSAHDKDGHGTHCAGTIFGRDLDGTRIGVARGVGRALIGKVL      180
181      GPGGGGSDTIAEAILWARDNGAHVISMSLGIDFPGFVEKLVTLRGLSIPVATSLALRAYT      240
241      ANVQLFETLSQFLAAGIGQPMVVAATGNESGRDRTPPFEIDVAPPAAAAGIVAVGALGRT      300
301      ANGLAVAPFSNARATVSAPGVGVVSAAVGGGTESMSGTSMATPHAAGVAALWAEKLAAQG      360
361      QLAPLVLQAKLIGEATTDRLIPGTDPTDTGAGLVRAPQS                           399