Sequence for MER0041206

>MER0041206 - mycosin-1 [S08.131] peptidase unit: 48-401 ( active site residue(s): 106,137,253,345  ) (Nocardia farcinica) (Source: MEROPS) 
1        MNRRLGLRRGAGTVGAAVVLGAAVFALPASAAAIGPPVVDDGALGAALAISGRPAPLEPT       60
61       EQRSVCAEPILTGAPPVEPPLAQAVLDLPTAWQFSRGAGQKVAVIDTGVNRHPRLRALQA      120
121      GGDYVADTDGTVDCDGHGTLVAGIIAAAPSPDDAFAGVAPDAEILAIRQLSLAYEPKDRR      180
181      SGEQSGAITTSGYGNVLTLAGAVVRAVDMGATVINISEVACSAAGATPEDAALGAAVKYA      240
241      FDRNVVVVAAAGNLTSEGACKTQNERPGWSSVQTVASPAWFDPYVLSVASIDPNGMVSEL      300
301      SLHGPWVRAAAIGRRIVSLDSKPGATGLVDGVQTSEGISPIEGTSFAAPYVSGLVALVRA      360
361      RFPELNAAQVIDRVVRTAHAPGTGRDDKLGHGLIDPVAALTAELPDQPVHAGADTPRPLA      420
421      EPARPPGPDPLPRRVAVIGSITSLAVLGVGAALSIPFRNRRELDLDHLDREVLDREVTEG      480