Sequence for MER0041205

>MER0041205 - mycosin-1 [S08.131] peptidase unit: 44-386 ( active site residue(s): 86,118,233,330  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSASFGIGANAGVAHADRPPAVNPGLKPPGDPAAPPEKTERPANSACADILTGGDGPTIP       60
61       EAQRALDLERAWKFSKGAGQRVAVIDTGVARHPRLPGLEAGGDFVANSGDGTEDCDGHGT      120
121      LVAGIIAASQVEGQGFAGVAPEAQIITIRQTSKMYQKEGRSAEKAPDEFPDSYGNLNTMA      180
181      SAIVRAADLGATVINISEVWCGTGSPDADNKVGAALHYAAIEKDVVVVVAAGNKDDKCKG      240
241      ENQVIDPLDPTADPWSKVTYNISPARWDDYVLSVGSIDANGAPSSFTIPGPWLGVAASGE      300
301      NMVSLDPRGTGTAIGVVDQRGQQGAVSGTSFATPIVAGVAALVRARFPELSALEVIKRIQ      360
361      ATAHAPAEGWNPYIGYGAVDPIAALTNAVPGELPPKRPTPAKSRQLAVPAPPPPPNNTPR      420
421      NVALIGSGVIAGALVLGYLASFPIRRRFGVSGDDM                               455