Sequence for MER0041204

>MER0041204 - subfamily S1E unassigned peptidases [S01.UPE] peptidase unit: 218-440 ( active site residue(s): 256,297,381  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLLPRIGRSRPAARQTRFRKSVIAASAAILLFGPTAAVANAEPAPATDLPAQLVEALNRD       60
61       LKLSPEEYLRRADLAQQVAAFATTAQRQYPQVFGGSWLDDAGKAIVALAQGPGAEEARAA      120
121      AESAGFEVRNVAKSEATLRGEKTAFERWLETQPEAVSALIRGVVIDTVNNSIAVRVDQPG      180
181      VPMPSFVDPSRVIVMTPPAAGEPVPQAGAIADELARGELAGGDGYTSVGGEGQLRCSFGF      240
241      NGTDRSGAVVNISAGHCNPDVASAGTPNAAAVHELLSGERNGGRLGVFQKSVLGSQDYSI      300
301      IKIDDAVTGRFANNGVRVPGAAPVRIEGVATPVVGAPVCKSGSRTGFSCGIVNAVDQTVQ      360
361      VGERELTQSFSANICALPGDSGGPIVTGRMALGISSASSVADYPMCAIPNLIGALTGNAP      420
421      QLFAQPVSVVLSDNPGLRIRTT                                            442