Sequence for MER0041203

>MER0041203 - MarP peptidase ({Mycobacterium tuberculosis}) [S01.513] peptidase unit: 219-367 ( active site residue(s): 234,263,341  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSSSVWLDVVVVVLALAAAASGWRQGAVASALAFLGVVLGAVAGILIAPHILVHVDEGRT       60
61       RVLTGVLLIVVLVIVGEVAGMVLGRAARSGMRHPFTRSVDSIVGAALQAVAVLVIAWLLA      120
121      LPLATSSQPAIASAINGSRVLADVNEVAPNWLRKVPNEFSRLLNTSGLPDVIGPFGRAPI      180
181      AAVEPPDPSVLASPVAASLQQSVLRIRGVAPSCQRALEGSGFVIAPERVMTNAHVVAGTT      240
241      SVSVDTARGPLEASVVLFDPSKDIAVLAVPGLTAPVIPQASAAARSGDSAIVLGYPGGGP      300
301      YTASAARVRETLDLTGPTIYRNGTVEREVYTVRGLVRAGNSGGPLVDTQGQVLGVVFGAA      360
361      VTDDDTGYVLTLSEVRTELEAAPGATLPVDTGGCVLS                             397