Sequence for MER0041202

>MER0041202 - subfamily S1C unassigned peptidases [S01.UPC] peptidase unit: 85-251 ( active site residue(s): 101,132,216  ) (Nocardia farcinica) (Source: MEROPS) 
1        MQDEPRGSGGRWSALLVAAVLALAGFLGFRGELPGWPFGDTGTTAAPTVRPPNPPLDQAA       60
61       VAAEVTPALVNISTRTRPLGQGAAGTGIVLTADGQVLTSHHVVKGAEQVVVTTQATGAEY      120
121      RATVLGYDSTADIALLSLPGANGLPTARLGSSSSVRVRDEVLALGNAGGTGGPPTATPGL      180
181      VTALNSTIVALNAADLSRKALRGMVEVAAPVSSGQSGGALVDWQGAVVGVVTASSGEAAA      240
241      ELERPNGYAVPIDTAMRVVRQIRSGIPTDTVHIGPTATLGVLISDASPSGARIDVALYGL      300
301      PAYAAGLADGEVIVSIDGRPIGSARVLRTAIDRRRPGETVRLGVLGVDGVERTVTVELGL      360
361      GTPN                                                              364