Sequence for MER0041200

>MER0041200 - Htra2 peptidase ({Mycobacterium}-type) [S01.494] peptidase unit: 130-305 ( active site residue(s): 146,179,264  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTEDFQAAPQHANPQHPHGHYPTQPFSGPHPGMPAATPPPQAPARPARTGLVAAAVALAL       60
61       VSGGVGGAVGAVVTRSDDGRAPVTNALDAPKPSVSNVSNAPAGSTQAVAQKVLPSVVMIK      120
121      VASNRAEGEGSGVVLSSDGLILTNNHVASGGGTGARMEVHFADGSTAPATVVGADPVSDL      180
181      AVIKAQGRTDLTPIELGTSASLQVGQPVIAIGSPLGLAGTVTTGIVSALNRPVSTSGEGT      240
241      QNPNAPQPVIDAIQTDAAINPGNSGGALVDYEGKLIGINTAIATLGAGELGGQQSGSIGL      300
301      GFAIPVDQARRVADELIKTGQATYAQIGIKLRPQDTAALVLEATPGGPAAAAGIPAGAII      360
361      TKLDDRVIDSGEALIAAVRSHQPGDKVKVTYTDENGNNPKTVEVTLTGAPGDGGR           415