Sequence for MER0041199

>MER0041199 - PH0974 dipeptidase [M24.034] peptidase unit: 145-373 ( active site residue(s): 216,305,316 metal ligand(s): 233,245,309,338,352 ) (Nocardia farcinica) (Source: MEROPS) 
1        MSSHTHARFAADVYADRLERAVESMRAAHLDALLITPGPDLRYLVGSAAQSFERLTCLVI       60
61       TSDGATPSVVIPKLELAALADSAVGELGLRVLDWVDGVDPYQLVRSTLHAGSRVAVADAM      120
121      PALHLIPLAASFSGLPVSATPVLRELRMIKDAAEIEALRRAGAAIDRVHARMGEFLQVGR      180
181      TEAEVGDDIAAALVEEGHLEADFVIVGSGPHGADPHHGVSQRRIERGDVVVIDIGGPVEP      240
241      GYFSDCTRTYSMGEPASEIAARFAELERAQAAAVAAVRPGVTAESVDAAARNLLTEAGFG      300
301      DAFVHRTGHGIGLSVHEEPYIVAGNDLPLRPGMAFSIEPGIYFRGEWGARIEDIVVVTED      360
361      GCESMNNRPHGLTVL                                                   375