Sequence for MER0041198

>MER0041198 - subfamily M24B unassigned peptidases [M24.UPB] peptidase unit: 142-375 ( active site residue(s): 216,304,315 metal ligand(s): 233,244,308,337,351 ) (Nocardia farcinica) (Source: MEROPS) 
1        MSADPAGLVPDYAARRGALRSLLVENEVDALLVTDLVNIRYLTGFTGSNAALLVHSWDMR       60
61       NAEDRTVLGTDGRYRDQVAAQVPDLRAEIARATARRIVELAGEWQLGRIGFESHAVTVDQ      120
121      HRGFVEQRTGLEFVATPGLVEQLRMVKDAYEVEQLRRACAAGDAGLAALLARGGLRPGRT      180
181      ERQVARDLEWAMFEHGAEAVSFETIVATGVNSAIPHHRPTDAVLAPGDFVKIDFGAVVDG      240
241      YHSDMTRTFVLGHAADWQREVYELVAEAQRAGSKALRPGVAAGEVDAASRSVIEAAGHGK      300
301      LFVHGLGHGVGLRIHEAPGIAKNAPGTLLSGVAVTVEPGVYFPGRGGVRIEDTLVVREGG      360
361      PELLTHTSKDLTVVD                                                   375